SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021300 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021300
Domain Number 1 Region: 18-112
Classification Level Classification E-value
Superfamily POZ domain 5.89e-24
Family Tetramerization domain of potassium channels 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021300   Gene: ENSSSCG00000023436   Transcript: ENSSSCT00000023467
Sequence length 232
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:13542997:13548578:-1 gene:ENSSSCG00000023436 transcript:ENSSSCT00000023467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQLLIKVKSTANQNLESPVVELNVGGEFYTTTLGTLRKIPGSKLAEMFSSSAKACTDAEG
RFFIDHPGTYFGPILEYLRSGQLPRQHIPEVYREAQYYEIEPLVKLLEDMPQIFGEQVAR
KQFLLRVPGYSENLQLMVRLARAEAVAARYSEVLVCVVHNEKDDANCVDTLRLLEADKRS
VVKFGPWKAAPTIDHLLDCVKMDIKAQGYQVQCSKHLGLPANYFYTFCFTWW
Download sequence
Identical sequences ENSSSCP00000021300 ENSSSCP00000021300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]