SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021308 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021308
Domain Number 1 Region: 169-423
Classification Level Classification E-value
Superfamily YWTD domain 5.1e-46
Family YWTD domain 0.000000000776
Further Details:      
 
Domain Number 2 Region: 84-161,424-474
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000753
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 3 Region: 3-41
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.00016
Further Details:      
 
Domain Number 4 Region: 43-75
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000969
Family LDL receptor-like module 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021308   Gene: ENSSSCG00000028512   Transcript: ENSSSCT00000029210
Sequence length 518
Comment pep:known_by_projection scaffold:Sscrofa10.2:GL896440.1:2830:14728:1 gene:ENSSSCG00000028512 transcript:ENSSSCT00000029210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVATCRPDEFQCSDGTCIHGSRQCDREYDCKDLSDEQGCVNVTLCEGPNKFKCQSGECIS
LDKVCNSVRDCXDWSTQPPPGAGTNECLDNKGGCSHICNDLKIGYECLCPEGFQLVDKHR
CEDIDECQDPDACSQICVNLEGSYKCQCEEGFQLEPLTKACKAIVSFLHLLFSNXHKKRG
MXLDRSEYTSLIPNLKNVVALDTEVASNRIYWSDLSQRKIYSTQINRAPSFSSYDTIIGE
DLQAPDGLAVDWIHSNIYWTDSILGTVSVADTKGVKRKTLFQEKGSKPRAIVVDPVHGFM
YWTDWGTPAKIKKGGLNGVDVYSLVTEDIQWPNGITLDLSGGRLYWVDSKLHSISSIDVN
GGNRKTVLEAFSLAIFEDKVFWTDVINEAIFSANRLTGSDIHLMAENLLSPEDIVLFHNL
TQPRGVNWCERTALQNGGCQYLCLPAPQINPRSPKFTCACPDGMLLAKDMRSCLTETEPA
GTTQGPSMVNSTAVGPKHTASSELTTAESVTMSQHGKG
Download sequence
Identical sequences ENSSSCP00000021308 ENSSSCP00000021308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]