SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021310 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021310
Domain Number 1 Region: 117-300
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.23e-55
Family SPRY domain 0.0000188
Further Details:      
 
Domain Number 2 Region: 33-91
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000199
Family RING finger domain, C3HC4 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021310   Gene: ENSSSCG00000004426   Transcript: ENSSSCT00000027290
Sequence length 300
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:88131679:88134311:1 gene:ENSSSCG00000004426 transcript:ENSSSCT00000027290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FKMITTISLFIIYHHTDYSELCIFPSTVRTMANNLQDEAACTVCLEVFFSPITLSCTHTF
CLYCMQSWMKEQEDLKLVCPMCRGVIENPPLKDWQIEELALLITQHSSRLEQGMHMSDEY
LKFWEDITLDPATANSFLVFSEDLRSIQYGKIYQNLMEDPQRFDYWAGVLGTPCFVSGCH
YWEVEVGEGNEWALGVCKMSVNRKRPSGFSSDHGFWIIRMKAGTIYTFSVLETRIPVSPG
LCHVGVFLDIELEEIKFFDVSNDVLIYTHNNLSCLEPLCPFFSLELPREGEKGASLKICP
Download sequence
Identical sequences ENSSSCP00000021310 ENSSSCP00000021310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]