SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021312 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021312
Domain Number 1 Region: 965-1076
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000439
Family Growth factor receptor domain 0.0096
Further Details:      
 
Domain Number 2 Region: 821-952
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000691
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 391-434
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000357
Family EGF-type module 0.002
Further Details:      
 
Domain Number 4 Region: 467-585
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000001
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 5 Region: 568-692
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000267
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 6 Region: 351-391
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000268
Family EGF-type module 0.00072
Further Details:      
 
Domain Number 7 Region: 430-472
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000569
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 8 Region: 145-280
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000251
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 9 Region: 119-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000001
Family EGF-type module 0.0023
Further Details:      
 
Domain Number 10 Region: 1085-1127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000128
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 766-802
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000123
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 12 Region: 1160-1210
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000474
Family EGF-type module 0.013
Further Details:      
 
Domain Number 13 Region: 272-312
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000911
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 14 Region: 82-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000118
Family EGF-type module 0.013
Further Details:      
 
Domain Number 15 Region: 314-356
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000161
Family EGF-type module 0.017
Further Details:      
 
Domain Number 16 Region: 696-732
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000168
Family EGF-type module 0.015
Further Details:      
 
Domain Number 17 Region: 3-39
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000339
Family EGF-type module 0.027
Further Details:      
 
Domain Number 18 Region: 41-80
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000893
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000021312
Domain Number - Region: 1117-1157
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000171
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 734-768
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000929
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 1203-1237
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00589
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021312   Gene: ENSSSCG00000023899   Transcript: ENSSSCT00000029966
Sequence length 1250
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:61892253:61908778:-1 gene:ENSSSCG00000023899 transcript:ENSSSCT00000029966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APPCLDGSPCANGGRCTQLPSREAACLCPPGWVGEWCQLEDPCHSGPCAGRGVCQSSVVA
GTARFSCRCPRGFRGPDCSLPDPCLSSPCAHGARCSVGSDGRYICSCPPGYQGRSCRSDV
DECRVGGPCRHGGTCLNTPGSFHCQCPAGFTGPLCESPAVPCAPSPCRNGGTCRQSGDLT
YDCACLPGFEGQNCEVNVDDCPGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQ
LQPNACHNGGTCFNTLGGHSCVCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCA
CPMGKTGLLCHLDDACVSNPCHEDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGA
NPCEHLGRCVNTQGSFLCQCGRGYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMA
GFTGTYCEVDMDECQSSPCVNGGVCKDKVNGFSCTCPSGFSGAMCQLDVDECASTPCRNG
AKCVDQPDGYECRCAEGFEGTVCERNVDDCSPDPCHHGRCVDGIASFSCACAPGYTGTRC
ESQVDECRSQPCRHGGKCLDLVDKYLCRCPPGTTGVNCEVNIDDCASNPCTFGLCRDGLN
RYDCVCQPGFTGPLCNMEINECASSPCGEGGSCVDGENGFRCLCPPGSLPPLCLPPSHPC
AQEPCSHGVCHDAPGGFRCVCEPGWSGPQCSQSLTRDACESHPCRAGSTCTSDATGFHCT
CPPGVQGRQCELLSPCVPNPCEHGGHCESATGQLVVCSCPSGWQADPCLNGGSCQDGVGS
FSCSCLPGFAGPRCARDVDECLSSPCGPGTCTDHVASFTCTCPPGYGGFRCEQDLPDCSP
SSCFNGGTCVDGVTSFTCLCRPGYTGAHCQHEADPCLSRPCLHGGICTAAHPGFRCACPE
GFTGAQCQTLVDWCSRVPCQNGGRCARAGASFYCLCPPGWSGRLCDIQSLPCREAAAQIG
VPVEQLCQAGGQCVDKDGSHYCVCPEGRTGSHCEQEVDPCLAQPCQHGGTCQGYMGGYVC
ECPAGYTGDNCEDDVDECASQPCQHGGFCIDLVARYLCSCPPGTLGVLCEINEDDCGLGS
PLDLDPRCLHNGTCVDLVGGFRCSCPPGYTGLRCEADINECRPGACHAAHTRDCLQDPGG
GFHCLCHAGFTGPRCQTVLSPCESQPCQHGGQCRPSPGPGGALTFSCHCVLPFWGPRCER
VARSCRELQCPVGVPCQQTVRGPRCACPPGLSGPACRGSRGSPPGAVNSS
Download sequence
Identical sequences ENSSSCP00000020647 ENSSSCP00000021312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]