SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021318 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021318
Domain Number 1 Region: 55-355
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.21e-44
Family beta-glycanases 0.029
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000021318
Domain Number - Region: 548-670
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000285
Family Laminin G-like module 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021318   Gene: ENSSSCG00000027865   Transcript: ENSSSCT00000023979
Sequence length 685
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:116348931:116415759:-1 gene:ENSSSCG00000027865 transcript:ENSSSCT00000023979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERRLQASRQRRVKVMTAAAGSAGQVAVTLLLCALLAPGSSYVLDDSDGLGREFDGIGA
VSGGGATSRLLVNYPEPYRSQILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYA
LDENYFRGYEWWLMKEAKKRNPNITLIGLPWSFPGWLGKGFNWPYVNLQLTAYYVMTWIV
GAKHYHDLDIDYIGIWNERAFDANYIKVLRRMLNYQGLQQVKIIASDNLWEPISASMLLD
SELMKAIDVIGAHYPGTRTVKDARLTEKKLWSSEDFSTLNNDVGAGCWGRILNQNYINGY
MTSTIAWNLVASYYEQLPYGRCGLMTAQEPWSGHYAVEAPIWISAHTTQFTQPGWYYLKT
VGHLEKGGSYVALTDGLGNLTIIVETMSHKHSLCIRPFLPYFNVSHQFATFVLKGSFREI
PELQVWYTKLGKPSKRYLFKQLDSLWLLDSSGSFTLELHEDELFTFTTLTTGNKGSYPPP
PKSQPFPCVYEDDFNVDYPYFSEAPNFADQTGVFEYFMNIEDPGEHRFTLRQVLNQRPIT
WAADAFNTISVIGDYKWSNLTIKCDVYIETSETGGVFIAGRVNKGGILIRSARGVFFWIF
ANGSYQVTGDLAGWIIYTSGYADIKAKKWYTLTLTIKGGSSSGTLNGKLLWKNVSVNFPK
NGWAAIGTHSFEFAQFDNFRVEATC
Download sequence
Identical sequences F1SDZ2
ENSSSCP00000021318 ENSSSCP00000021318 9823.ENSSSCP00000002620 9823.ENSSSCP00000002622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]