SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021328 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021328
Domain Number 1 Region: 5-130
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.3e-48
Family Galectin (animal S-lectin) 0.00000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021328   Gene: ENSSSCG00000021728   Transcript: ENSSSCT00000032011
Sequence length 131
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:7795558:7802455:1 gene:ENSSSCG00000021728 transcript:ENSSSCT00000032011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGKVEIMNMDMKVGKTLKIKGKIDDDADGFVINLGQGTDKLALHFNPRFGESTIVCNSR
DGNSWGKEQRDSHMCFSPGSEVKLIVTFEEDGFKVKLPDGHQLTFPNRLGYSHLSYLSVQ
GGFSITSFKLD
Download sequence
Identical sequences I3LBA9
ENSSSCP00000021328 ENSSSCP00000021328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]