SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021370 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021370
Domain Number 1 Region: 203-550
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.14e-93
Family Calpain large subunit, catalytic domain (domain II) 0.00012
Further Details:      
 
Domain Number 2 Region: 691-812
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 3.66e-26
Family Calpain large subunit, middle domain (domain III) 0.0018
Further Details:      
 
Domain Number 3 Region: 546-682
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 3.27e-23
Family Calpain large subunit, middle domain (domain III) 0.0072
Further Details:      
 
Domain Number 4 Region: 79-160
Classification Level Classification E-value
Superfamily MIT domain 2.35e-18
Family MIT domain 0.0023
Further Details:      
 
Domain Number 5 Region: 6-81
Classification Level Classification E-value
Superfamily MIT domain 0.000000000000119
Family MIT domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021370   Gene: ENSSSCG00000030697   Transcript: ENSSSCT00000022738
Sequence length 813
Comment pep:known chromosome:Sscrofa10.2:13:2379271:2430518:1 gene:ENSSSCG00000030697 transcript:ENSSSCT00000022738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAAALERDAVQFARLAVQRDHEGRYSEAVFYYKEAAQALIYAEMAGSSLEHIQEKINEY
LERVQALHSAVQSKSADPLKSKHQLDLERAHFLVTQAFDEDEKGNVEDAIELYTEAVDLC
LKTSYETADKTLQNKLKQLARQALDRAEALSEPLTKPLCKVKATNIKPKPPPTRTHFPLG
TNPFQERPQPFISPQSCDAQGQRYTAEEIEVLRTTSKINGIEYVPFMNIDLRERFAYPMP
FCDRCGKLPLSPKQKAMFSKWVRPEDLTNNPTMIYTVSSFSIKQTIVSDCSFVASLAISA
AYERRFNKKLITSIIYPQNKDGEPEYNPCGKYMVKLHLNGVPRKVIIDDQLPVDHKGELL
CSYSNNKSELWVSLIEKAYMKVMGGYDFPGSNSNIDLHALTGWIPERIAMHSDSQSFSKD
NSFRMLYQRFHKGDVLITASTGVMTEAEGEKWGLVPTHAYAVLDIREFKGLRFIQLKNPW
SHLRWKGRYSENDVKNWTPELQKYLNFDPRTAQKIDNGIFWISWDDLCQYYDVIYLSWNP
SLFKESTCIHSTWDAKQGPVKDAYSLANNPQYKLEVQCPQGGAAVWVLLSRHITDKDDFA
NNREFITMVVYKTDGKKVYYPADPPPYIDGIRINSPHYLTKIKLTTPGTHTFTLVVSQYE
KQNTIHYTVRVYSACSFTFSKIPSPYTVSKQINGKWSGQSAGGCGNFQETHKNNPIYQFH
IEKSGPLLIELRGPRQYSVGFEVVTVSVVGDPGPHGFQRKSSGDYRCGFCYLELESIPAG
IYNIIPSTFLPKQEGPFFLDFNSVIPIKTTQLQ
Download sequence
Identical sequences ENSSSCP00000021370 ENSSSCP00000021370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]