SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021376 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021376
Domain Number 1 Region: 53-245,290-316
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.93e-32
Family YicI catalytic domain-like 0.0062
Further Details:      
 
Domain Number 2 Region: 8-49
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.00000000119
Family YicI N-terminal domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021376   Gene: ENSSSCG00000030453   Transcript: ENSSSCT00000025214
Sequence length 316
Comment pep:known chromosome:Sscrofa10.2:13:112769213:112777723:1 gene:ENSSSCG00000030453 transcript:ENSSSCT00000025214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALEDESHAHGVLLLNSNAMDVTFQPTPALTYRIIGGILDFYMFLGPSPEVATKQYHEVI
GRPVMPPYWALGFQLCRYGYRNTSQVEEVYNDMVTAQIPYDVQYTDIDYMERQLDFTIGE
EFRELPKFVDKIRNEGMRYIIILDPAISGNETEPYPAFDRGQEKDVFVKWPNTSDICWAK
VWPDLPNVTIDESLTEDEAVNASRAHVAFPDFFRNSTAEWWAREIIDFYNNQMKFDGLWI
DMNEPSSFVNGTTTNQCRNTELNYPPYFPELTKRTEGLHFRTMCMETEQILSDGSSVLHY
DVHNLYGWSQVKPTYE
Download sequence
Identical sequences ENSSSCP00000021376 ENSSSCP00000021376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]