SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021383 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021383
Domain Number 1 Region: 152-274,428-485,538-688
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.49e-97
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000199
Further Details:      
 
Domain Number 2 Region: 782-893
Classification Level Classification E-value
Superfamily DUSP-like 1.83e-24
Family DUSP, domain in ubiquitin-specific proteases 0.0028
Further Details:      
 
Domain Number 3 Region: 7-91
Classification Level Classification E-value
Superfamily RING/U-box 5.53e-23
Family Zf-UBP 0.0000222
Further Details:      
 
Domain Number 4 Region: 687-784
Classification Level Classification E-value
Superfamily DUSP-like 7.06e-20
Family DUSP, domain in ubiquitin-specific proteases 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021383   Gene: ENSSSCG00000024341   Transcript: ENSSSCT00000023659
Sequence length 918
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:303892886:303935551:1 gene:ENSSSCG00000024341 transcript:ENSSSCT00000023659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDSRDPCPHLDSIGEVTKEDLLLKSKGTCQSCGVAGPNLWACLQVSCSYVGCGESFADH
STIHAQVKTHNLTVNLTTFRVWCYACEKEVFLEQRLAAHPPGPSPKFSEQVALRSSCQDS
PPPPCHPLKAVPIAVADEGESESEDDDLKPRGLTGMKNLGNSCYMNAALQALSNCPPLTQ
FFLECGGLVRTDKKPALCKSYQKLVTEVWHRKRPSYVVPTSLSHGIKLVNPMFRGYAQQD
TQEFLRCLMDQLHEELKEPRVAAALPEARDSDSSDSDEKREGDRSPSEDEFLSCDSSSDR
GEGDGQGRGGGGSPAETELLIPDEAGRAISEKERRKDRRFSWGQQRTSSEQVDEDADVDT
AMAALDQQPTDTQPPSPRSTKPDNEAHMRSASRPCSPVHHHEGHAKLAGSPPRASPVRMG
PSYVLKKAQVPSTGSRRRKEQQYRSVISDIFDGSILSLVQCLTCDRVSTTVETFQDLSLP
IPGKEDLAKLHSAIYQNVPAKPGACGDSYAAQGWLAFIVEYIRRFVVSCTPSWFWGPVVT
LEDCLAAFFAADELKAPGDNMYSCERCKKLRNGVKYCKVLQLPEILCIHLKRFRHEVMYS
FKISSHVSFPLEGLDLRPFLAKECTSQITTYDLLSVICHHGTAGSGHYIAYCQNVINGQW
YEFDDQYVTEVHETLVQNAEAYVLFYRKSSEEALRERQQVVSLAAMREPSLLRFYVSREW
LNKFNTFAEPGPITNHTFLCSHGGIPPNKYHYIDDLVVILPQNVWEHLYNRFGGGPAVNH
LYVCSICQVEIEALAKRRRIEIDTFIKLNKAFQAEESPSVIYCISMQWFREWEAFVKGKD
NEPPGPIDNSRIAQVKGSGHIQLKQGADYGQISEETWVYLLSLYGGGPEIAIRQSVAQLQ
DPESLHGEQKIEAETRAV
Download sequence
Identical sequences ENSSSCP00000021383 ENSSSCP00000021383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]