SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021394 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021394
Domain Number 1 Region: 24-110
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 1.8e-28
Family Ribosomal L11/L12e N-terminal domain 0.0000141
Further Details:      
 
Domain Number 2 Region: 101-173
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 5.36e-16
Family Ribosomal protein L11, C-terminal domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021394   Gene: ENSSSCG00000009848   Transcript: ENSSSCT00000010794
Sequence length 191
Comment pep:novel chromosome:Sscrofa10.2:14:36226375:36226950:-1 gene:ENSSSCG00000009848 transcript:ENSSSCT00000010794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SARRRPRPNFLQLSRIQVHPTPATSTMPPKFNPNEIKAMYLRCTSGEISAKSALAPKIGP
LGLSPKEVGDDIAKAAGDWKGLRITVKPTIQNRQAQMEVVPSASALIIKAPKELPRDRKK
QKNIKHSGNITFDEIVNIARQMRRCSLARELSGTIKEILGTAQSVGCNVNGRRPHDIIDD
ISSGAVECQAS
Download sequence
Identical sequences ENSSSCP00000021394 ENSSSCP00000021394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]