SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021434 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021434
Domain Number 1 Region: 24-112
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 4.45e-30
Family Ribosomal L11/L12e N-terminal domain 0.0000132
Further Details:      
 
Domain Number 2 Region: 101-174
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.000000000000089
Family Ribosomal protein L11, C-terminal domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021434   Gene: ENSSSCG00000014809   Transcript: ENSSSCT00000016160
Sequence length 191
Comment pep:novel chromosome:Sscrofa10.2:9:7480967:7481542:-1 gene:ENSSSCG00000014809 transcript:ENSSSCT00000016160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SARRWPGCGFLQLSQIRMHPTPAATTMPPKFDPKEIKVMYLRCTGGEGGAPSALAPKIGP
PGLSPKKVGDDITKATGDWKGLRITVKLTIPNRQAQMEVVPSGSALIIKALKELPRDRKK
QKNIKHSGNITFVETVSIARQMRHHSLAGELSGTLKEILGTAQSVGCNVGGRHPHAIIDD
IHRGAVECPAS
Download sequence
Identical sequences ENSSSCP00000021434 ENSSSCP00000021434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]