SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021537 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021537
Domain Number 1 Region: 37-130
Classification Level Classification E-value
Superfamily FKBP-like 1.57e-28
Family FKBP immunophilin/proline isomerase 0.00000223
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021537   Gene: ENSSSCG00000023312   Transcript: ENSSSCT00000027975
Sequence length 131
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:65779491:65791734:1 gene:ENSSSCG00000023312 transcript:ENSSSCT00000027975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKGKSASGKGGKGKVASGSDSADKKPQGPKGGGNAVKVRHILCEKHGKILEAMEKLKS
GMKFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPISVLDKPVFTDPPVKTKF
GYHIIMVEGRK
Download sequence
Identical sequences I3LBW5
ENSSSCP00000021537 XP_003135228.1.46622 ENSSSCP00000021537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]