SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021567 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021567
Domain Number 1 Region: 245-381
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000012
Family Growth factor receptor domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021567   Gene: ENSSSCG00000010109   Transcript: ENSSSCT00000029167
Sequence length 866
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:54455011:54465602:1 gene:ENSSSCG00000010109 transcript:ENSSSCT00000029167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGAGPRGAGPARRRGAGGPPPRLLPPPPLLLLLWLLPGPAAPQELSPRGRNVCRAPGSQ
ELTCCIGWRQQGDECGIAVCEGNSTCSENEVCVRPGECRCRHGYFGANCDTKCPRQFWGP
DCKELCVCHPHGQCEDVTGQCTCHARRWGARCEHACQCQHGACHPRSGACRCEPGWWGAQ
CASACYCSATSRCDPQTGACLCHSGWWGRSCNNQCACNSSPCEQQSGRCQCRERTFGARC
ERYCQCFRGRCHPVDGTCSCEPGYRGKYCREPCPAGFYGGCRRRCGQCKGQQPCTVAEGR
CLTCEPGWNGTKCDQPCSTGFYGEGCGHRCPPCRDGHSCNHVTGKCTRCNAGWIGDRCET
KCSNGTYGEDCAFVCADCGSGHCDFQSGRCLCSPGVHGPHCNLTCPPGLHGVDCAQACSC
HEDSCDPVTGACRLETNQRKGVMGAGALLALLLGLLLSLLGCCCACRGKDPARGELTFGR
KKAPQRLCGRFSRISMKLPRIPLRRQKLPKVVVAHHDLDNTLNCSFLEPPSGLEQPSPSW
SSRASFSSFDTTDEGPVYCVPHEEAATESRDAEAPTAPASAETLAQSPAPVATPAPAEEA
TPLPASSDSERSASSGDGPGGALYARVARREARPARVRGEARGLSLSPSPERRKPPPPDP
ATKPKVSWIHGKHGAAAAARAPSPLPAGPEAAPSPSKRKRTPSDTSARPEEPGSPRARDP
TPRHPGLAEEGPALASPSPPRARARGRGPGLPEPTDAGGPPRSAPEAASMLAAELRDKTR
SLGRAEGALGTQVPREKPAPPQKAKRSVPPASPARAPPAPEAPGPEKAAAGAPGTDTPRK
KTPIQKPPRKKSRRCGALCACSFPLL
Download sequence
Identical sequences ENSSSCP00000021567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]