SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021587 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021587
Domain Number 1 Region: 856-914
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000654
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 2 Region: 626-692
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000759
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 3 Region: 747-801
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000116
Family TSP-1 type 1 repeat 0.0073
Further Details:      
 
Domain Number 4 Region: 48-105
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000301
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 5 Region: 801-861
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000392
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 6 Region: 569-629
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000144
Family TSP-1 type 1 repeat 0.0088
Further Details:      
 
Domain Number 7 Region: 694-744
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000759
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021587   Gene: ENSSSCG00000026425   Transcript: ENSSSCT00000028900
Sequence length 958
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:307095608:307128748:1 gene:ENSSSCG00000026425 transcript:ENSSSCT00000028900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGRWQPSRWAWSLLTMALVAGGASSTGATDNSPTSNSLEAGADATASWWGEWTKWTACS
RSCGAGVTSQERHCLQQRRTSVTGAGNRTCTGTSKRYQLCRVQECPADGRSFREEQCISF
NSRVYNGRTHQWKPLYPDDYVHISSKPCDLHCTTVDGQRQLMVPAHDGTSCKLADLRGVC
VSGKCEPIGCDGVLFSTHTLDKCGVCQGDGSSCTHVTGNYRKGNAHLGYSLVTHIPAGAR
DIQIVERKKSADVLALADEAGYFFFNGNFKVDSPKNFNIAGTVVKYRRPMDVFETGIEYI
VAQGPTNQGLNVMVWNQNGKSPSITFEYTLLQPPHAHRLQPLYYSFSEPVAQSAESVDSA
ELDGAGLLGFLRHNGSLYGQASSERLGLDNRLFGRRGPGIELGLSKGQETNEVCVQASGR
ACEGPPRGKGFRDSNTTGTALEGDQRDPEADARFASQERLSANAISDQLLGTGSDSKELA
PNETVNSIFAQGGPRSSPAESLYVDYEENEGAGTYLLNGSYLQLSSDRVTNTSAEAPFPN
ASASLPALGGNRTQKARTRPKARKPGVSPADMYRWKLSSHEPCSATCTTGVMSTYAMCVR
YDGIEVDDSYCDALTRPEPVQEFCAGRECQPRWETSSWSECSRTCGEGYQFRIVRCWKML
SPGFDSSVYSDLCEAAEAVRPEERKTCRNPACGPQWEMSEWSECTAKCGERSVVTRDIRC
SEDEKLCDPNTRPVGEKDCTGPPCDRQWTVSDWGPCSGSCGQGRMIRHVYCKTSDGRVVP
ESQCQMETKPLAIHPCGDKNCPAHWLAQDWERCNTTCGRGVKKRLVLCMELANGKPQTRS
GPECGLAKKPAEESTCFERPCFKWYTSPWSECTKTCGVGVRMRDVKCYQGTDIVRGCDPL
VKPVGRQACDLQPCPTEPPDDSCQDQPGTNCALAIKVNLCGHWYYSKACCRSCRPPHS
Download sequence
Identical sequences I3LC14
ENSSSCP00000021587 XP_005654665.1.46622 ENSSSCP00000021587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]