SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021647 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021647
Domain Number 1 Region: 2-355,385-404
Classification Level Classification E-value
Superfamily Thiolase-like 1.87e-72
Family Thiolase-related 0.0025
Further Details:      
 
Domain Number 2 Region: 492-617,680-777
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 2.3e-40
Family FabD-like 0.0054
Further Details:      
 
Domain Number 3 Region: 1229-1354
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.00000000000224
Family UbiE/COQ5-like 0.073
Further Details:      
 
Domain Number 4 Region: 617-673
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0000000392
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021647   Gene: ENSSSCG00000029944   Transcript: ENSSSCT00000029960
Sequence length 1375
Comment pep:known chromosome:Sscrofa10.2:12:1023477:1034681:-1 gene:ENSSSCG00000029944 transcript:ENSSSCT00000029960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEVVIAGMSGKLPESENLEEFWANLIGGVDMVTADDRRWKAGLYGLPRRMGKLKDLSRF
DASFFGVHSKQANTMDPQLRMLLEVTYEAIVDGGINPASLRGTSTGVWVGVSSSDASEAL
SRDPETLVGYSMIGCQRAMMANRVSFFFDFKGPSITIDTACSSSLLALQSAYQAIRGGEC
SAAVVGGLNVLLKPNSSLQFMKLGMLSQDGTCRSFDAEGTGYCRAEAVVAVLLTKKSLAR
RVYATILNAGTNTDGSKEQGVTFPSGDVQEQLIRSLYAPAGPDPESLEYIEAHGTGTKVG
DPQELNGIVNALCATRREPLLIGSTKSNMGHPEPASGVAALIKVLLSLEHGVWAPNLHYH
TPNPEIPALQDGRLQVVDRPLPIRGGNVGINSFGFGGSNVHVILQPNSRPAPPPAQHAAL
PRLLQASGRTLEAVQTLLEQGLRHSRDLAFVGMLNEIAAVSPVAMPFRGYAVLGGEAGSQ
EVQQVPGSKRPVWFICSGMGAQWQGMGLSLMRLDRFRDSILRSDQALKPLGLRVSDLLLS
TDEAVLDDIVSSFVSLTSIQIALIDLLTSLGLQPDGIIGHSLGEVACGYADGCLTQEEAV
LSSYWRGYCIKEANVLPGAMAAVGLSWEECKQRCPPGIVPACHNSKDTVTISGPQAAMSE
FLQQLKREDVFVKEVRTGGIAFHSYFMESIAPTLLRQLRKVILDPKPRSKRWLSTSIPEA
QWQGSLARTFSAEYSVNNLVSPVLFQEALQHVPAHAVVVEIAPHALLQAVLKRSLESSCT
IIPLMKKDHRDNLEFFLSNVGRLHLAGVSVNPNGLFPPVEFPAPRGTPLISPHIKWDHSQ
AWDVPSAADFPSGSSCSSVAVYKFDVSPESPDHYLVDHCIDGRVLFPGTGYLWLTWKTLA
RALSQNLEETPVVFEDVTLHQATILPKTGTVSLEVRLLEASHAFEVSDSNGSLIASGKVY
QWESPDPKLFDTRAAVDPADSTAEFRLSQGDVYKDLRLRGYDYGPFFQLVLESDLEGNRG
RLQWNDSWVSFLDAMLHMSILAPGQLGLYLPTRFTSIRIDPITHRQKLYTLQDTTQAADV
VVDRNLNTVVAGGALFLGAHSSVAPRRPQEHLKPILEKFCFTPHVESGCLAGNTALQEEL
QLCRGLAQALQTKVAQQGLKMVVPGLDGAQAPREAPQQSLPRLLAAACQLQLNGNLQLEL
GQVLAQERPLLCDDPLLSGLLDAPALKACVDTALENMASPKMKVVEVLAGDGQLYSRIPA
LLNTQPVMDLDYTATDRNPQALEAAQAKLEQLHVTQGQWDPANPAPGSLGKADLLVCNCA
LATLGDPAVAVGNMAATLKEGSFLMLHTLLAGHPHGETGGFLTSPEQGCRILLIQ
Download sequence
Identical sequences ENSSSCP00000021647 ENSSSCP00000021647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]