SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021733 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021733
Domain Number 1 Region: 7-265
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.99e-88
Family Eukaryotic proteases 0.00000422
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021733   Gene: ENSSSCG00000023849   Transcript: ENSSSCT00000025134
Sequence length 267
Comment pep:known_by_projection scaffold:Sscrofa10.2:GL896204.1:72113:74185:-1 gene:ENSSSCG00000023849 transcript:ENSSSCT00000025134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LICTTMLLLSLTLSLVLLSSSWXVPAIKPALNFNQRIVNGENAVPGSWPWQVSLQDSNGF
HFCGGSLISQSWVVTAAHCNVVPGRHFVILGEYDLSSSTEPLQVLSISQAITHPSWNPTT
MNNDLTLLKLASPAQYTTRISPVCLASSNEALPEGLTCVTTGWGRLSGVGNVTPARLQQA
VLPLVTVSQCQQYWGSRITNSMICAGASGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTS
NCNVYAPAVYTRVSKFNTWINQVIAYN
Download sequence
Identical sequences ENSSSCP00000021733 ENSSSCP00000021733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]