SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021755 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021755
Domain Number 1 Region: 89-256
Classification Level Classification E-value
Superfamily Cytochrome c 2.45e-61
Family Cytochrome bc1 domain 0.0000000432
Further Details:      
 
Domain Number 2 Region: 257-302
Classification Level Classification E-value
Superfamily Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor 4.71e-16
Family Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor 0.000099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021755   Gene: ENSSSCG00000020682   Transcript: ENSSSCT00000028031
Sequence length 302
Comment pep:novel chromosome:Sscrofa10.2:4:759850:762137:-1 gene:ENSSSCG00000020682 transcript:ENSSSCT00000028031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAAAASLRGAVLGPRGAGLPGARARGLLCGPRPGQLPLRTPQALSLSSKSGLSRGRKV
ILSALGMLAAGGAGLAVALHSAVSATDLELHAPSYPWSHRGLLSSLDHTSIRRGFQVYKQ
VCSSCHSMDYVAYRHLVGVCYTEEEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPY
PNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTAIAMAPPIYNEVLEFDDGTPATM
SQVAKDVCTFLRWASEPEHDHRKRMGLKMLMMMGLLLPLVYAMKRHKWSVLKSRKLAYRP
PK
Download sequence
Identical sequences ENSSSCP00000021755 ENSSSCP00000021755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]