SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021792 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021792
Domain Number 1 Region: 59-116
Classification Level Classification E-value
Superfamily Kringle-like 1.34e-19
Family Fibronectin type II module 0.0043
Further Details:      
 
Domain Number 2 Region: 125-170
Classification Level Classification E-value
Superfamily Kringle-like 1.57e-16
Family Fibronectin type II module 0.002
Further Details:      
 
Domain Number 3 Region: 28-71
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000214
Family Fibronectin type II module 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021792   Gene: ENSSSCG00000003125   Transcript: ENSSSCT00000026368
Sequence length 170
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:49168387:49187810:1 gene:ENSSSCG00000003125 transcript:ENSSSCT00000026368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRWSSYLLGCTAFILYSYETSGDTKDSCVFPFNYKGFTYFSCTRTNSLSPWCATRAVYD
GQWKYCLIEDYPRCVFPFIYRGRSHRNCIVEGSFFGKLWCSVTSSFDEKQQWKYCEINGI
SSLVPGFPCHFPFNYKNKNYFNCTTKGSKENLLWCATSYNYDQDHTWVYC
Download sequence
Identical sequences I3LCL7
ENSSSCP00000021792 XP_005664699.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]