SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021918 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021918
Domain Number 1 Region: 279-448
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-41
Family SPRY domain 0.00011
Further Details:      
 
Domain Number 2 Region: 7-69
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000182
Family RING finger domain, C3HC4 0.023
Further Details:      
 
Domain Number 3 Region: 85-147
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000143
Family B-box zinc-binding domain 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000021918
Domain Number - Region: 149-217
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.0824
Family C-terminal domain of PLC-beta 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021918   Gene: ENSSSCG00000024966   Transcript: ENSSSCT00000022766
Sequence length 450
Comment pep:novel chromosome:Sscrofa10.2:9:25821515:25865704:1 gene:ENSSSCG00000024966 transcript:ENSSSCT00000022766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSTSVQCFPSEFICSICQDCFTDPVTISCGHRFCTPCLCLMWEDAHTPTCCPVCKAISP
TMDFKSTILAKEHILPTRKSVVCQLPSSAKWMCRKHQVIKNYFCQTNKSLLCLCCSHSPE
HATHVHYPIQQAAEHCRENLLIHMKSIWKKKQENQRNIKKVTSIFRVWEGFVNHRMMMIR
AEYPKVCQYLQEEKRRHLEILATEGKIVFRRLRGNVTRMIHMGKLLRRIYGELKEMCLKG
DVEMLQDVGDIVKRSEKLQLHVPQPIVPQLSSWPIAGLMDWLHQFQVYFASDKETVTRHV
PVFEDLQRWLSGPDRPGVDNTPTRLKYFLAWGAESFTSGQHYWEVNMAGCCNWAIGLCND
SWAKKNDMALESEGIFLLFCIQENQQCSLFTSSPLTPQYVQRPLGQVGVFLDYEAGLVSF
IDVATSSLICSFLSCSFSSALKAFLCSGHP
Download sequence
Identical sequences ENSSSCP00000021918 ENSSSCP00000021918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]