SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021954 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021954
Domain Number 1 Region: 147-246
Classification Level Classification E-value
Superfamily Immunoglobulin 5.48e-26
Family I set domains 0.00018
Further Details:      
 
Domain Number 2 Region: 52-145
Classification Level Classification E-value
Superfamily Immunoglobulin 1.58e-24
Family I set domains 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021954   Gene: ENSSSCG00000030433   Transcript: ENSSSCT00000023242
Sequence length 271
Comment pep:known chromosome:Sscrofa10.2:6:53921293:53922926:1 gene:ENSSSCG00000030433 transcript:ENSSSCT00000023242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPCSLCVLRAPGSPPAAQPGPRGGDAMTPTLPALLCLGLSVGLGTQVQAGTLPKPTLWAE
PGPLVTWYSPVTIWCQGTLGAQEFLLYTEGSPTPWYRLSPLEAGDKAKFSIPYMTQDYAG
RYRCYYISPTGRSEPSDALELVVTGAYEKPALSALPSPVVASGGNVTLQCGSGHGYDRFI
LTKEGEHKSFWTLDTQRYPNRQTRALFPMGPVTPSHRGTFRCYGSFRDKPQVWSPPSDPL
ELLVSGEGGPAWSQRLWGPSPRLGSLRPTSP
Download sequence
Identical sequences ENSSSCP00000021954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]