SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021966 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021966
Domain Number 1 Region: 22-344
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.62e-111
Family Calpain large subunit, catalytic domain (domain II) 0.0000000784
Further Details:      
 
Domain Number 2 Region: 349-497
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 1.96e-39
Family Calpain large subunit, middle domain (domain III) 0.0000921
Further Details:      
 
Domain Number 3 Region: 517-623
Classification Level Classification E-value
Superfamily EF-hand 7.56e-16
Family Penta-EF-hand proteins 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021966   Gene: ENSSSCG00000024781   Transcript: ENSSSCT00000031281
Sequence length 684
Comment pep:novel chromosome:Sscrofa10.2:3:114886292:114914857:1 gene:ENSSSCG00000024781 transcript:ENSSSCT00000031281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLWSSLGGCWKLGCEDWMQSSSQLPKQDYEALQERCLIDGCLFEDQSFPATLRSIGRGP
LLRKLPERVYWRRPPELHSNPQFYSAKAKRLDLCQGLVGDCWFLAALQALTLHQDILSRV
VPLNQSFTEKYAGIFRFWFWHFGKWIPVVVDDRLPVNEAGQLVFVSSTYKNLFWGALLEK
AYAKLSGSYEDLQRGQVSEALVDFTGGVTMTINLVEAPCNLWDILTRAIYSRTLIGCQTH
AGKERVLENGLVDGHAYTLTGIRKVTSKHGPEYLVKLRNPWGKVEWKGDWSDSSSTWELL
SPKERILLLRKENDGEFWMTLRDFKTHFTLLVICKLSPGLLSQEVGQTWLYTMLEGRWEK
GTTAGGQMRSPRDMFWKNPQFLLSVWRPQECRRLHMPCSVLVSLLQKPRHRHRNRKPYLA
IGFYLFRMNQSYDNQRRLPPEFFRENAPLNWPETFLTEKEVSRELWLEPGTYLIVPCTSE
PRQESEFVLRVFSRSHVFYEIGSSSSVVFSKEIVDPNEGQDEFFTKVFEKYPEINAIQLQ
KILNRMPWSGLGSKPPLFSLEACQGILALLDLNASGTVSIQEFRHLWKQLMFYQKVFHKQ
DTHRSGSLNWAQLQAAMREAGRRGERSSCWLPRGWGWRLEIKCFQFTHTHTHTHTHTRVF
QNLTQDGRGIYLRKPEWLMMSLYS
Download sequence
Identical sequences ENSSSCP00000021966 ENSSSCP00000021966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]