SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021973 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021973
Domain Number 1 Region: 209-471
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.06e-90
Family Eukaryotic proteases 0.0000612
Further Details:      
 
Domain Number 2 Region: 126-233
Classification Level Classification E-value
Superfamily SRCR-like 2.62e-19
Family Hepsin, N-terminal domain 0.051
Further Details:      
 
Domain Number 3 Region: 92-130
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000034
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021973   Gene: ENSSSCG00000022568   Transcript: ENSSSCT00000022288
Sequence length 475
Comment pep:novel chromosome:Sscrofa10.2:13:216115054:216136125:-1 gene:ENSSSCG00000022568 transcript:ENSSSCT00000022288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSPEKEVEVEVEPGIRGPEIVTMGENDPPAAEAPFSFRSLFGLDDLKISPVAPDADAVAA
QILSLLPLKFFPILVVGIIALILALAIGLGIHFDCSGKYRCRSSFKCIELAARCNGVADC
REGEDEYRCVRVSGRNAALQVFTAAAWRTVCSEDWKAHHASVACAQLGFPSYVSSDTLRV
DLLEEPFREDFVSINHLLPDDKVTALHHAVYVREGCASGHVVTLTCSACGRRMGSSPRIV
GGNASSLAQWPWQASLQFQGYHLCGGSVITPVWVVTAAHCVYDLYLPKSWTIQVGLVSLL
DSPAPSHLVEKIIYHSKYKPKRLGNDIALMKLAGPVAFNEMIQPVCLPNSEENFPDGKMC
WTSGWGATEDGGDASPVLNHAAVPLLSNKLCNHRDVYGGLISPSMLCAGYLKGGVDSCQG
DSGGPLVCQERTVWKLVGATSFGIGCAEANKPGVYTRITSFLDWIHEQMERDLKT
Download sequence
Identical sequences ENSSSCP00000021973 ENSSSCP00000021973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]