SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021997 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021997
Domain Number 1 Region: 106-164
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000068
Family VWC domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021997   Gene: ENSSSCG00000028549   Transcript: ENSSSCT00000024689
Sequence length 165
Comment pep:known chromosome:Sscrofa10.2:3:43457582:43480380:1 gene:ENSSSCG00000028549 transcript:ENSSSCT00000024689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SNGEKASMKFSGLYCFLLLLICQTDYGQNEETSRKQRRKMYYRRLRKSSLPTHRSSRQLG
IQQMIATPAATLPMVNLDYSTEEKFESFLSVPGVESSYNVLPEKKGHCLANGMIMYNRAV
WSPEPCTTCLCSNGRVLCDETKCHPQLCSRTVIPEGECCPVCSDT
Download sequence
Identical sequences ENSSSCP00000021997 ENSSSCP00000021997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]