SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022033 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022033
Domain Number 1 Region: 735-1314
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 4.71e-204
Family Myeloperoxidase-like 0.000000000405
Further Details:      
 
Domain Number 2 Region: 62-249
Classification Level Classification E-value
Superfamily L domain-like 4.76e-43
Family Ngr ectodomain-like 0.0014
Further Details:      
 
Domain Number 3 Region: 342-436
Classification Level Classification E-value
Superfamily Immunoglobulin 3.85e-28
Family I set domains 0.016
Further Details:      
 
Domain Number 4 Region: 429-521
Classification Level Classification E-value
Superfamily Immunoglobulin 1.8e-25
Family I set domains 0.0088
Further Details:      
 
Domain Number 5 Region: 527-615
Classification Level Classification E-value
Superfamily Immunoglobulin 1.38e-24
Family I set domains 0.023
Further Details:      
 
Domain Number 6 Region: 245-340
Classification Level Classification E-value
Superfamily Immunoglobulin 7.83e-23
Family I set domains 0.014
Further Details:      
 
Domain Number 7 Region: 1414-1472
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000157
Family VWC domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022033   Gene: ENSSSCG00000029570   Transcript: ENSSSCT00000022979
Sequence length 1479
Comment pep:known chromosome:Sscrofa10.2:3:141717172:141773584:1 gene:ENSSSCG00000029570 transcript:ENSSSCT00000022979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVHPARPARPCLLALVMCCCWGVLAVVAQKPGNGCPSRCLCFRTTVRCMHLLLEAVPAV
APQTSILDLRFNRIREIQPGAFKGLRNLNTLLLNNNQIKSIPSGSFEDLENLKYLYLYKN
EIQSIDRQAFQGLASLEQLYLHFNQIETLDPESFQHLPKLERLFLHNNRITYLVPGTFNH
LESMKRLRLDSNALRCDCEILWLADLLKTYARSGNAQAAATCEYPRRIQGRSVATITPEE
LDCERPRITSEPQDADVTLGNTVFFTCRAEGNPKPEIIWLRNNNELSMAADSRLNLLDDG
TLMIQNTREADQGVYQCMAKNVAGEAKTQGVTLRYFGSPARPAFVIQPQNTEVLVGESVT
LECSATGHPPPRITWTRGDGTPVPVDPRVSITPSGGLYIQNVVQEDSGEYTCFAANTVDS
VHATAFIIVQALPQFTVTPQDRAVTEGQTVDFHCEAKGYPQPVIAWTKGGSPLSVDRRHL
VLSSGTLRISSVALHDQGQYECQAVNIIGSQRVTAHLTVQARVTPVFASVPSDVTAEVGS
SVQLPCSSQGEPEPAITWNKDGVQVTESGKFHISPEGFLTIHDVGTADAGRYECVARNTM
GQASVSMLLSVNVPDVSRNGDPFVATSIVEAIATVDRAINSTRTHLFDSRPRSPNDLLAL
FRYPRDPYTVEQARAGEIFERTLQLIQEHVRHGLLVDLNGTGYHYNDLVSPQYLGLIANL
SGCTAHRRVNNCSDMCFHQKYRTHDGTCNNLQHPMWGASMTAFERLLKAVYENGFNTPRG
IDPSRRYHGHPLPVPRLVSTALIGTEAVTPDEQFTHMLMQWGQFLDHDLDSTVVALSQAS
FSDGQHCSATCSSDPPCFSVAIPPDDPRARSGARCMFFVRSSPVCGSGMTSLLMNSVYPR
EQINQLTSYIDASNVYGSSEHEARAIRDLASQRGLLRQGIVQRSGKPLLPFAAGPPTECM
RDENESPIPCFLAGDHRANEQLGLTSMHTLWFREHNRVAAELLALNPHWDGDTIYHEARK
VVGAQVQHITYQHWLPKVLGEAGMKMLGEYRGYDPGVNAGIVNAFATAAFRFGHTLINPV
LQRLDENFQPIAHGHVPLHKAFFSPFRIVNEGGIDPLLRGLIGVAGKMRVPSQLLNTELT
ERLFSMAHTVALDLAAINIQRGRDHGIPPYHDFRAYCNLSAAHTFEGLKNEIKNPEIREK
LRRLYGSPLNIDLFPALMVEDLVPGSRLGPTLMCLLSTQFKRLRDGDRLWYENPGVFSPA
QLTQIKQTSLARILCDNADNITRVQRDVFRVAEFPHGYSSCAEVPRMDLRVWQDCCEDCR
TRGQFNAFSYHFRGRRSLEFSYQEDGPAREAGPAKMPSRGKQPGMRLSNATATSLERPQV
PGTGDVREFVLEVQKTIAELRRQIKTLESRLSTECVDADGEPHADGTQWKRDPCTLCGCR
DGQVTCFVETCQPADCPAPVRVGGACCPVCPGASAGRGP
Download sequence
Identical sequences ENSSSCP00000022033 ENSSSCP00000022033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]