SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022064 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022064
Domain Number 1 Region: 16-77
Classification Level Classification E-value
Superfamily DNA-binding domain 0.0000101
Family Methyl-CpG-binding domain, MBD 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022064   Gene: ENSSSCG00000026846   Transcript: ENSSSCT00000031526
Sequence length 269
Comment pep:novel scaffold:Sscrofa10.2:JH118928.1:112504:115006:-1 gene:ENSSSCG00000026846 transcript:ENSSSCT00000031526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGGNESSGADRAGGPVATSVPIGWQRCVREGAVLYISPSGTELSSLEQTRSYLLSDGTC
KCGLECPLNVPKVFNFDPLAPVTLGGAGVGPASEEDMTKLCNHRRKAVAMATLYRSMETT
CSHSSPGEGASPQLFHTVSPGPPSARPPCRVPPTTPLNGGPGSLPPETPSVPQAFPPLAG
PGGLFPQPRLPDPVPSGGSSSPCFLPRGNAPSPAPPPPPAISLNAPSYNWGAALRSSLVP
PDLGSPPAPHASSSPPSDPPLFHCSDALX
Download sequence
Identical sequences ENSSSCP00000022064 ENSSSCP00000022064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]