SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022089 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022089
Domain Number 1 Region: 154-349
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-38
Family SPRY domain 0.00023
Further Details:      
 
Domain Number 2 Region: 13-82
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000631
Family RING finger domain, C3HC4 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022089   Gene: ENSSSCG00000025208   Transcript: ENSSSCT00000031373
Sequence length 352
Comment pep:known chromosome:Sscrofa10.2:7:25145454:25150172:1 gene:ENSSSCG00000025208 transcript:ENSSSCT00000031373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAPELLGPGLVERLEQLATCPLCGGPFEDPVLLACEHSFCRACLARCWGTPPATGPETP
PTACPCCGLPCPRRCLRSNVRLAVEVRISRGLREKLAEPGARTGKRRGGRIPTMGCLDQQ
GEDMRKTWRRFDAPTPRSSNSEDELPEDYPVVKNMLHRLTADLTLDPGTAHRRLLVSADR
RSVRLAPPGTPVPPDGPARFDQLPAVLGAQGFGAGRHCWEVETADAASGDSSGEDEDDGE
SLYAVGAAGESVRRKGRVGLCPAGAVWAVEGRGGRLWALTAPEPTLLGGAGPPPRRIRVD
LDWERGRVAFYDGHSLDLLFAFQGPGPLGERVFPLLCTRDPRAPLRIVPAEG
Download sequence
Identical sequences B6ICU6
NP_001121918.1.46622 ENSSSCP00000022089 ENSSSCP00000022089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]