SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022091 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022091
Domain Number 1 Region: 167-223
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 1.83e-16
Family TSP-1 type 1 repeat 0.00023
Further Details:      
 
Domain Number 2 Region: 13-76
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.000000000137
Family Reprolysin-like 0.013
Further Details:      
 
Domain Number 3 Region: 465-519
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000144
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 4 Region: 515-576
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000157
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022091   Gene: ENSSSCG00000029488   Transcript: ENSSSCT00000031950
Sequence length 577
Comment pep:known chromosome:Sscrofa10.2:13:200326440:200330429:1 gene:ENSSSCG00000029488 transcript:ENSSSCT00000031950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTYTLTRVLDFFLGHVFNMPHDDAKQCASLNGVNRDSHMMASMLSNLDRSQPWSPCSAYM
ITSFLDNGHGECLMDKPQSPIQLPSDLPGTLYDANRQCQFTFGEESKHCPDPASTCTTLW
CTGTSGGLLVCQTKHFPWADGTSCGEGKWCVNGKCVNKTDKKHFDTPVHGSWGPWGPWGD
CSRTCGGGVQYTMRECDNPVPKNGGKYCEGKRVRYRSCNIEDCPENNGKTFREEQCEAHN
EFSKASFGSGPPVEWTPKYAGVSPKDRCKLICQAKGIGYFFVLQPKVVDGTPCSPDSTSV
CVQGQCVKAGCDRIIDSKKKFDKCGICGGNGSTCKKISGSVTSAKPGYHDIVTIPTGATN
IEVKQRNQRGSRNNGSFLAIKAADGTYILNGDFTLSTLEQDITYKGSVLRYSGSSAALER
IRSFSPLKEPLTIQVLTVGNALRPKIKYTYFVKKKKESFNAIPTFSEWVIEEWGECSKTC
GLGVQRRLVECRDINGQPASECAKEVKPASTRPCADLPCPHWQLGDWSPCSKTCGKGYKK
RTLQCLSHDGGVLAHESCDPLKKPKHYIDFCTMAECS
Download sequence
Identical sequences ENSSSCP00000022091 ENSSSCP00000022091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]