SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022093 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022093
Domain Number 1 Region: 8-54
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000972
Family Laminin G-like module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022093   Gene: ENSSSCG00000021012   Transcript: ENSSSCT00000022610
Sequence length 56
Comment pep:novel chromosome:Sscrofa10.2:9:121709215:121709382:-1 gene:ENSSSCG00000021012 transcript:ENSSSCT00000022610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YLNQMSNSSHSVLQPSFQGCMQLIQVDDQLVNLYEVAQRRPGSFANVSIDMCAIID
Download sequence
Identical sequences ENSSSCP00000022093 ENSSSCP00000022093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]