SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022143 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022143
Domain Number 1 Region: 178-424
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.05e-88
Family Eukaryotic proteases 0.000061
Further Details:      
 
Domain Number 2 Region: 799-1046
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.48e-86
Family Eukaryotic proteases 0.00018
Further Details:      
 
Domain Number 3 Region: 472-724
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.57e-85
Family Eukaryotic proteases 0.00011
Further Details:      
 
Domain Number 4 Region: 19-99
Classification Level Classification E-value
Superfamily SEA domain 0.00000131
Family SEA domain 0.014
Further Details:      
 
Domain Number 5 Region: 141-180
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000119
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022143   Gene: ENSSSCG00000028363   Transcript: ENSSSCT00000031657
Sequence length 1047
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:76709686:76741715:-1 gene:ENSSSCG00000028363 transcript:ENSSSCT00000031657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AASLSTQGVLVEHTAELRGIRFACSLQQESSDYYRMLTPTLEALFVSSFEETELEASCLG
CTVLSYQDGNGSVLVHIRLRFLLQPLRTLRPGLEEELLQRGLHRRLQGHGLPLATYGTIA
SVWLTGSQRGLLTERDLKSGRCVGNAFSCGNSQCVTKVNPECDDTADCSDGTDEAHCDCG
LQPGWRTVGRIVGGVEAAPGEFPWQVSLRENNEHFCGAAVISARWLVSAAHCFNEFQDPT
EWVVYAGTTYLSGLEASTVRARVARIITHPLYNSDTADFDVAVLELGGPLPFSRHVQPVC
LPAATHVFPPRKKCLISGWGYLKEDFLVKPEMLQKATVELLDQALCANLYGHSLTDRMVC
AGYLDGKVDSCQGDSGGPLVCEEPSGRFFLAGIVSWGIGCAEARRPGVYARVTRLRDWIL
EAITLTSKPLAPTVAPTPPTPRTAWPTSPKSPVVDTHTKPTLAPSTAPLHLPTASKLQEC
GVRPALEKPTRIVGGFGAASGEVPWQVSLKEGSRHFCGATVVGDRWLLSAAHCFNHTKVE
LVRAHLGTTSLSGISGSPVKMGLRRAVLHPQYNPSILDFDVAVLELARPLVFNKYVQPVC
LPLAIQKFPVGRKCMISGWGNTQEGNATKPDILQRASVGIIDQKACSALYNFSLTDRMIC
AGFLEGKVDSCQGDSGGPLACEETPGVFYLAGIVSWGIGCAQAKKPGVYTRITRLKGWIV
DTMSSHPTPPLATTRTLASSLATRTAAGPTVPGITASRPTPLATSRVTSQPANRTATAMT
TTARGETPLPHVPKPTMGIQLPDCGLAPAAALTRIVGGSAAGRGEWPWQVSLWLRRREHR
CGAVLVAERWLLSAAHCFDVYGDPKQWAAFLGTPFLSGADGQLERVVRIHKHPFYNVYTL
DYDVALLELAGPVRRSRLVRPICLPEPGPRPPDGARCVITGWGSVREGGSMARQLQKAAV
RLLSEQTCRRFYPVQISSRMLCAGFPQGGVDSCSGDAGGPLACRDPSGRWVLTGVTSWGY
GCGRPQFPGVYTRVAAVRGWIWQNIQE
Download sequence
Identical sequences ENSSSCP00000022143 ENSSSCP00000022143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]