SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022151 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022151
Domain Number 1 Region: 4-58
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000183
Family TSP-1 type 1 repeat 0.00086
Further Details:      
 
Domain Number 2 Region: 117-164
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000955
Family TSP-1 type 1 repeat 0.00092
Further Details:      
 
Domain Number 3 Region: 58-113
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000235
Family TSP-1 type 1 repeat 0.00068
Further Details:      
 
Domain Number 4 Region: 567-836
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000513
Family Rhodopsin-like 0.041
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000022151
Domain Number - Region: 175-218
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00109
Family Hormone receptor domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022151   Gene: ENSSSCG00000023005   Transcript: ENSSSCT00000022604
Sequence length 865
Comment pep:novel chromosome:Sscrofa10.2:6:82142945:82154104:1 gene:ENSSSCG00000023005 transcript:ENSSSCT00000022604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CFLAVHGVWEEWGSWSLCSRSCGRGSRSRMRTCVPPQHGGKACEGPELQTKLCSMAACPV
EGQWLEWGPWGPCSTSCANGTQQRSRKCSVAGPAWATCTGALTDTRECGNLECPATDGKW
GPWNAWSLCSKTCDTGWQRRFRMCQATGAQGYPCEGTGEEVKPCSEKRCPAFHEMCRDEY
VMLMTWKKAAAGEIIYNKCPPNASGSASRRCLLSAQGVAYWGLPSFARCISHEYRYLYLS
LREHLAKGQRMLAGEGMSQVVRSLQELLARRTYYSGDLLFSVDILRNVTDTFKRATYVPS
ADDVQRFFQVVSFMVDAENKDKWDDAQQVSPGSVHLLRVVEDFIHLVGDALKAFQSSLIV
TDNLVISIQREPVSAVSSDITFPMRGRRGMKDWVRHSEDRLFLPKEVLSLSSPGKPAASA
SGAAGSLGRGRGPGTVPPGPGHSHQRLLPADPEEASSYFVIGAVLYRTLGLILPPPRPPL
AVTSRVMTVTVRPPTQPPAEPLITVELSYIINGTTDPHCASWDYSRADASSGDWDTESCQ
TLETQAAHTRCQCQHLSTFAVLAQPPKDLTLELAGSPSVPLVIGCAVSCMALLTLLAIYA
AFWRFIKSERSIILLNFCLSILASNILILVGQSRVLSKGVCTMTAAFLHFFFLSSFCWVL
TEAWQSYLAVIGRMRTRLVRKRFLCLGWGLPALVVAVSVGFTRTKGYGTSSYCWLSLEGG
LLYAFVGPAAVIVLVNMLIGIIVFNKLMARDGISDKSKKQRAGASLWSSCVVLPLLALTW
MSAVLAMTDRRSVLFQALFAVFNSAQGFVITAVHCFLRREVQDVVKCQMGVCRADESEDS
PDSCKNGQLQILSDFEKDVDLACQT
Download sequence
Identical sequences ENSSSCP00000022151 ENSSSCP00000022151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]