SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022222 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022222
Domain Number 1 Region: 236-456
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.84e-57
Family Reprolysin-like 0.00033
Further Details:      
 
Domain Number 2 Region: 546-601
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000209
Family TSP-1 type 1 repeat 0.00023
Further Details:      
 
Domain Number 3 Region: 888-944
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000196
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 
Domain Number 4 Region: 825-884
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000262
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 
Domain Number 5 Region: 939-1002
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000523
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 6 Region: 1002-1054
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000419
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022222   Gene: ENSSSCG00000026994   Transcript: ENSSSCT00000031250
Sequence length 1103
Comment pep:known chromosome:Sscrofa10.2:2:71100635:71119498:1 gene:ENSSSCG00000026994 transcript:ENSSSCT00000031250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPACQILRWALALGLGLAFKVTHTFRSQDEFLSSLESYEIAFPTRVDHNGALLAFSPPP
PRRQRRGTGPQAESRLFYKVAAPSTHFLLNLTRSPRLLAGHVSVEYWTREGLAWQRAARS
HCLYAGHLQGQAGSSHVAISTCGGLHGLIVADEEEYLIEPLQGGPQRHRGPEDSGPHVVY
KRSSLRHPHLDTACGVRDEKPWKGRPWWLRTLKPPPARPLGNETERGQPGLKRSVSRERY
VETLVVADKMMVAYHGRRDVEQYVLAIMNIVAKLFQDSSLGNIVNILVTRLILLTEDQPT
LEITHHAGKSLDSFCKWQKSIVNRSGHGNAIPENGVANHDTAVLITRYDICIYKNKPCGT
LGLAPVGGMCERERSCSINEDIGLATAFTIAHEIGHTFGMNHDGVGNSCGARGQDPAKLM
AAHITMKTNPFVWSSCSRDYITSFLDSGLGLCLNNRPPRQDFVYPTVAPGQAYDADEQCR
FQHGVKSRQCKYGEVCSELWCLSKSNRCITNSIPAAEGTLCQTHTIDKGWCYKRVCVPFG
SRPEGVDGAWGPWTPWGDCSRTCGGGVSSSSRHCDSPRPTIGGKYCLGERRRHRSCNTDD
CPPGSQDFREMQCSEFDSVPFRGKFYTWKTYRGGGVKACSLTCLAEGFNFYTERAAAVVD
GTPCRPDTVDICVSGECKHVGCDRVLGSDVREDKCRVCGGDGSACETIEGVFSPALLGAG
YEDVVWIPKGSVHIFIQDLNLSLSHLALKGDQESLLLEGLPGTPQPHRLPLAGTTFQLRQ
GPDQTQSLEALGPINASLIVMVLARTELPTLRYRFNAPIARDALPPYSWHYAPWTKCSAQ
CAGGSQVQAVECRSQLDSSAVAPHHCSAHSKLPKRQRACNTEPCPPDWVVGNWSRCSRSC
DAGVRSRSVVCQRRVSAAEEKALDDSACPQPRPPVLEACHGPACPPEWAALDWSECTPSC
GPGLRHRVVLCKSADQRATLPPAHCAPAAKPPATMRCNLRRCPPARWVTGEWGECSAQCG
FGQQQRPVRCSSHTGQPSRECAEALRPPATQQCEAKCDSTPAGDSLEECKDVNKVAYCPL
VLKFQFCSRAYFRQMCCKTCHGR
Download sequence
Identical sequences F8UV45
ENSSSCP00000022222 NP_001233179.1.46622 ENSSSCP00000022222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]