SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022329 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022329
Domain Number 1 Region: 184-328
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000122
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 2 Region: 94-132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000118
Family EGF-type module 0.012
Further Details:      
 
Domain Number 3 Region: 42-82
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000207
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 135-176
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000006
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 5 Region: 1-36
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000261
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022329   Gene: ENSSSCG00000022228   Transcript: ENSSSCT00000027062
Sequence length 374
Comment pep:novel chromosome:Sscrofa10.2:2:72634804:72644177:1 gene:ENSSSCG00000022228 transcript:ENSSSCT00000027062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NECTDTTMCPAYATCTNTSDSYYCSCKRGFLSTNGQMQFTMTLFSCPDIDECSQSPPVCG
PHSICKNLPGRYRCSCLTGFSSPTGNNWILGKKGRFICTDVNECANPKTCPEHAICRNSV
GSYSCVCKPGFESSRVFCLDGDECSRNSTPCGASSACTNLLGKYNCSCLPGFSPHNGPSY
FGDFSSPDIDECSQSPPACGPHSVCRNLPGSYKCSCLPGFSSPTGDDWIPAKGGRFACVD
INECLQSGVCPEHSQCTNSLGSYSCSCHVGFTSTNSICEGRSILATMTLFSCPDIDECSQ
SPPVCGPHSICKNLPGRYRCSCLTGFSSPTGNNWILGKKGRFICTGNMLERNSSLALESI
LTKRCAHILGRALG
Download sequence
Identical sequences ENSSSCP00000022329 ENSSSCP00000019577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]