SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022379 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022379
Domain Number 1 Region: 25-233
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.52e-37
Family Eukaryotic proteases 0.0000629
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022379   Gene: ENSSSCG00000029612   Transcript: ENSSSCT00000029326
Sequence length 235
Comment pep:novel chromosome:Sscrofa10.2:18:8207711:8214038:-1 gene:ENSSSCG00000029612 transcript:ENSSSCT00000029326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFILYLSVLAGTFFSAHSSVQKDDHAPYLVYLKSHFNPCVGVLIKSNWVLAPAHCYLPN
LKVMLGNFRIRVRDGTEQTINPIQIIRYWNHSHSAPQDDLMLIKLAKPATLNHKVQTLPL
ATSTVRPGTNCLLSGLDWSQDNNSRHPDLRQNLEAPVMADKDCQKTKQGKSHRNSLCVKF
VKVFSRIFGEVAVATVICQNKLQGIEVGQFMGGDVGIYTNVQKYVTWIENITKNK
Download sequence
Identical sequences I3LE93
ENSSSCP00000022379 ENSSSCP00000022379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]