SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022402 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022402
Domain Number 1 Region: 17-164
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.000000000109
Family Phosphate binding protein-like 0.00000941
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022402   Gene: ENSSSCG00000024560   Transcript: ENSSSCT00000030439
Sequence length 217
Comment pep:novel scaffold:Sscrofa10.2:JH118674.1:16622:55668:-1 gene:ENSSSCG00000024560 transcript:ENSSSCT00000030439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRKDKKTKRNSF
WLHPYHAKEPTVFIRNTHEPHLRKRKGWGVVLRMFKKKNSLHLSSQSPCVLVKVSGEVKE
LGLGLGTPQVSNLINPVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSL
SNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
Download sequence
Identical sequences ENSSSCP00000022402 ENSSSCP00000022402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]