SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022406 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022406
Domain Number 1 Region: 365-526
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.74e-51
Family Protein kinases, catalytic subunit 0.000000125
Further Details:      
 
Domain Number 2 Region: 54-216
Classification Level Classification E-value
Superfamily Fibronectin type III 2.12e-26
Family Fibronectin type III 0.00016
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000022406
Domain Number - Region: 2-51,86-112
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00785
Family Growth factor receptor domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022406   Gene: ENSSSCG00000024492   Transcript: ENSSSCT00000027070
Sequence length 533
Comment pep:novel chromosome:Sscrofa10.2:13:83718823:83816243:1 gene:ENSSSCG00000024492 transcript:ENSSSCT00000027070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XCPAGMFKASQEAEGCSHCPSNSRSPSEASPICTCRTGYYRADFDPPDVACTSVPSGPRN
VISIVNETSIILEWHPPRETGGRDDVTYNIICKKCRADRRSCSRCDDNVEFVPRQLGLTE
CRVSISSLWAHTPYTFDIQAVNGVSSKSPFPPQHVSVNITTNQAAPSTVPIMHQVSATMR
SITLSWPQPEQPNGIILDYEIRYYEKTEEVLNSEITTPLGCRPYSSYQSFSTEVWGIQAG
KAKDAARSPGVVMQCQFRTSCIYAATGKASLFQVLEDDEGKSTRQSLLHLLLGAKARGVR
LIVTSIIHISASCKRKRIYKRRASASTGLGHVRTGQKGSPGMKIYIDPFTYEDPNEAVRE
FAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEA
SIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIA
AGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSL
Download sequence
Identical sequences ENSSSCP00000022406 ENSSSCP00000022406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]