SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022449 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022449
Domain Number 1 Region: 69-103
Classification Level Classification E-value
Superfamily LysM domain 0.0000876
Family LysM domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022449   Gene: ENSSSCG00000024193   Transcript: ENSSSCT00000028243
Sequence length 306
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:100768674:100782019:-1 gene:ENSSSCG00000024193 transcript:ENSSSCT00000028243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRHQNRSYPLPGVHSSGQVHAFGNCTDSDILEEDAEVYELRSRGKEKIRRSTSRDRLD
DIIVLTKDIQEGDTLNAIALQYCCTVADIKRVNNLISDQDFFALRSIKIPVKKFSSLTET
LYPPKGRQASRPSSVHYLPEQQELQSANDSLSSSESAGSFLKEVDRDIEQIVKCTDTKRE
NLNEVVSALTTQQVRFEPDNKNIQRKDPYYGADWGIGWWTAVAIMLIVGIITPVFYLLYY
EILAKVDVSHHSTVDSSHLHSGVTPPSQQREMENGIAPTKGIPFGPQDDPKLYSQDAQLP
AAQHKT
Download sequence
Identical sequences F1RNY1
ENSSSCP00000022449 XP_003123827.1.46622 9823.ENSSSCP00000015051 ENSSSCP00000022449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]