SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022455 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022455
Domain Number 1 Region: 795-995
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.3e-41
Family Laminin G-like module 0.00038
Further Details:      
 
Domain Number 2 Region: 364-568
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.67e-41
Family Laminin G-like module 0.001
Further Details:      
 
Domain Number 3 Region: 36-233
Classification Level Classification E-value
Superfamily Fibronectin type III 5.62e-38
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 4 Region: 590-739
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.95e-20
Family Laminin G-like module 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022455   Gene: ENSSSCG00000016848   Transcript: ENSSSCT00000025413
Sequence length 1020
Comment pep:known_by_projection chromosome:Sscrofa10.2:16:24682029:24902072:1 gene:ENSSSCG00000016848 transcript:ENSSSCT00000025413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLIPGVLLQLLLLVSSLGPGVVPLRAALRKPGKVGPPLDIILDALNCTAFSIQWKMPRH
AGSSIMGYTVFYSEVGEEKALQEWSHTVPLSLDAPTTEEVIGNLKPGTEYRVSVAAYSQM
GKGRLSSPQHVTTLPQDSCLPPAAPQQPHVTVVSDSEVALSWKPGESEGSSPIQYYSVEF
IRPDLDRSWTLIQERIQMDSMVIKGLDPDTNYQFTVRAVNPHGSSPRSQPSDTIHTTQGP
EESGSGRYGPHYMTDTEGGEDGDGFEDDLDLDISFEEVKPLPAIKERNKNFLVESKMAPR
SNPMTISRLVPPTPASLPMTTVVPQPTPVERKGKTGVALMPRLFDMSCDETLCSADSFCV
NDYTWGGSRCHCNLGKGGESCSEDIVIQYPQFFGHSYVTFEPLKNSYQAFQITLEFRAEA
EDGLLLYCGENEHGRGDFMALAIIRRSLQFRFNCGTGVAIITSETKIKLGAWHTVTLYRD
GLNGLLQLNNGTPVTGQSQGQYSKITFRTPLYVGGAPSVYWLVRATGTNRGFQGCVQSLT
VNGKRMDLRPWPLGKALSGADVGECSSGICDEASCINGGTCTASKADTYICLCPLGFRGR
HCEDAFTLTIPQFRESLRSYAATPWPLEPRHYLSFMEFEMTFRPDSEDGVLLYSYDTGSK
DFLSITMAGGHVEFRFDCGSGTGVLRSQTAITLGKDHNIKKISQTAKSGLLLLIWHNHQL
VTESQKDGIFTFLSVNNIPYVEIILNHNTLPESTTVFLHIFSPKIILNDRTIHVKHDFTW
GVNVENAAHPCVGSPCAHGGSCRPRKEGYECDCPLGFEGLHCQKECGNYCLNTITEAIEI
PQFIGRSYLTYDNPAILKRVSGSRSNAFMRFKTTAKDGLLMWRGDSPMRPNSDFISLGLR
DGALVFSYNLGSGVASILVNGSFNDGRWHRVKAVRDGQSGKITVDDYGARTGKSPGMMRQ
LNINGALYVGGMKEIALHTNRQYMRGLVGCISHFTLSTDYHIALVEDAVDGKNINTCGAK
Download sequence
Identical sequences ENSSSCP00000017851 ENSSSCP00000022455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]