SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022472 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022472
Domain Number 1 Region: 146-462
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.64e-125
Family Transglutaminase core 0.0000000000141
Further Details:      
 
Domain Number 2 Region: 3-144
Classification Level Classification E-value
Superfamily E set domains 2.83e-42
Family Transglutaminase N-terminal domain 0.00000121
Further Details:      
 
Domain Number 3 Region: 469-585
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 4.71e-34
Family Transglutaminase, two C-terminal domains 0.00000167
Further Details:      
 
Domain Number 4 Region: 586-686
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.62e-28
Family Transglutaminase, two C-terminal domains 0.00000466
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022472   Gene: ENSSSCG00000023522   Transcript: ENSSSCT00000031001
Sequence length 687
Comment pep:known_by_projection chromosome:Sscrofa10.2:17:46592136:46629982:1 gene:ENSSSCG00000023522 transcript:ENSSSCT00000031001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEDLILERCDLELEANGRDHHTADLCRERLVVRRGQAFRLTLHFEGRNYEPSVDRLTFS
AVTGPAPSEEAGTKARFRLSDAAEEGAWRAEVVDQQDNTLSLQLSTPASAPIGLYRLNLE
ASTGYEGSSFLLGHFTLLFNAWCPADDVYLDSDEERQEYVLTQQGFVYQGSAKFIKSIPW
NFGQFEDGILDSCLMLLDVNPKFMRDAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGR
WDNNYGDGVSPMFWIGSVDILRRWKNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEFGEIQSDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIRRDDGSVYKSINRSL
VVGLKISTKSVGRDEREDITHTYKYPEGSPEEREAFTKANHLNKLADKEESEVAMRIRVG
EGMNMGSDFDVFAHITNNTAEEHTGRLLLCARTVSYNGVLGPECGTKDLLNFSLEPYSEK
SVPLRILYEKYCDCLTESNLIKVRGLLIEPAANSYLLAERDIYLENPEIKIRILGEPKQN
RKLVAEVSLRNPLTTPLSGCIFTVEGAGLTEEQKTVEIPDPVGAGEEVKVRVDLLPLLVG
RHKLVVNFNSNRLKAVKGFRNVIVGPS
Download sequence
Identical sequences ENSSSCP00000022472 ENSSSCP00000022472 9823.ENSSSCP00000007817 9823.ENSSSCP00000007821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]