SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022494 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022494
Domain Number 1 Region: 46-119
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 3.66e-23
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.0059
Further Details:      
 
Domain Number 2 Region: 1-45
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 7.85e-16
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022494   Gene: ENSSSCG00000029139   Transcript: ENSSSCT00000032470
Sequence length 135
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:6873379:6880903:-1 gene:ENSSSCG00000029139 transcript:ENSSSCT00000032470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLMRVSVGIHKEDIDAAIETYNLLSEKWFTHASPTLFNAGTNRPQLSSCFLLSMKDDSIE
GIYDTLKQCALISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDXX
XXXXXXXXXXXXXXX
Download sequence
Identical sequences ENSSSCP00000022494 ENSSSCP00000022494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]