SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022525 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022525
Domain Number 1 Region: 404-717
Classification Level Classification E-value
Superfamily ALDH-like 1.7e-98
Family ALDH-like 0.000000118
Further Details:      
 
Domain Number 2 Region: 1-191
Classification Level Classification E-value
Superfamily Formyltransferase 2.49e-45
Family Formyltransferase 0.0000000102
Further Details:      
 
Domain Number 3 Region: 195-297
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 2.35e-26
Family Post formyltransferase domain 0.00000158
Further Details:      
 
Domain Number 4 Region: 315-389
Classification Level Classification E-value
Superfamily ACP-like 0.00000677
Family Acyl-carrier protein (ACP) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022525   Gene: ENSSSCG00000030626   Transcript: ENSSSCT00000028556
Sequence length 718
Comment pep:known_by_projection scaffold:Sscrofa10.2:GL896523.1:1888:37407:-1 gene:ENSSSCG00000030626 transcript:ENSSSCT00000028556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIAVIGQSLFGQEVYNHLKEEGHKVVGVFTVPDQDGKVDPLCLKAEQDGVPVFKFTRWR
AKGQALPDVVAKYQALGAELNVLPFCSQFIPMVIYHPSLLPRHRGASSINWTLIHGDKKA
GFTIFWADDGLDTGDLLLQKECDVLPDDTVNTLYSRFLFPEGVKGMVQAVRLIAEGKAPR
LPQPEEGATYEGIQKKETARINWEQPAEAIHNWIRGNDKVPGAWTEACGQKLTFFNSTLN
TAGLVPEGEAVPIPGAHRPGVVTKAGLLLFGNDDQMLLVKNIQLEDGKMIPASQLFRGMD
NSALELTEEELATAEAVRGAWKRILPSVPEVDDSTDFFKSGAASVDVVRLVEEVKELCDG
MELENEDVYMATTFGDFIQLLVRKLRGDKESECVIDYVEKAVNKLTLHMPHQLFIGGEFV
DAEGARTYETINPTDGSVICQVALAQVSDVDKAVAAAKDAFEHGLWGRISARDRGRLLYR
LADLMEQHQEEXATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCDKIQGSTIPINQAR
PNRNLTLTRREPIGVCGIVIPWNYPLMMLSWKTAACLAAGNTAAFLPPQVTPLTALKFAE
LTLKAGIPKGVVNILPGSALSPHGQRISDHPDVRKIGFTGSTEVGKHIMKSCALSNVKKV
SLELGGKSPLIIFSDCDLSRAVQMGMSAVFFNKGENCIAAGRLFVENSIHDQFVQKVV
Download sequence
Identical sequences ENSSSCP00000022525 ENSSSCP00000022525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]