SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022595 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022595
Domain Number 1 Region: 6-244
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.11e-71
Family Eukaryotic proteases 0.000000685
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022595   Gene: ENSSSCG00000026750   Transcript: ENSSSCT00000025867
Sequence length 246
Comment pep:novel chromosome:Sscrofa10.2:7:79761692:79778290:1 gene:ENSSSCG00000026750 transcript:ENSSSCT00000025867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMFLLLLLVALLPPPPGEAGKIIGGHEVTPHSRPYMAYSVSKTSGRTSVCGGFLVSTNFV
LTAAHCWGSSIKVTLGGHNIQEKEETQQVIPVKNAICHPDYDSKICANDIMLLQLANRAR
QNRFVRPVALPRTQARLSPGAWCTVAGWGLVSLSRRTDTLQEVQLTVQRDGECHRRFRFY
NGRIEMCVGDPRERKSAFLGDSGGPLVCGRVAQGIVSYGNRQGTPPAVFTRVSSFLPWIR
RTMSRF
Download sequence
Identical sequences ENSSSCP00000022595 ENSSSCP00000022595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]