SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022637 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022637
Domain Number 1 Region: 2-60
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000307
Family Laminin G-like module 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022637   Gene: ENSSSCG00000029269   Transcript: ENSSSCT00000029655
Sequence length 88
Comment pep:novel scaffold:Sscrofa10.2:JH118863.1:69732:98945:1 gene:ENSSSCG00000029269 transcript:ENSSSCT00000029655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQGKIGVVFNIGTVDISIKEERTPVNDGKYHVVRFTRNGGNATLQVDNWPVNEHYPTGNT
DNERFQMVKQKIPFKYNRPVEEWLQEKG
Download sequence
Identical sequences ENSSSCP00000022637 ENSSSCP00000022637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]