SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022667 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000022667
Domain Number - Region: 13-114
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000218
Family Laminin G-like module 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022667   Gene: ENSSSCG00000029775   Transcript: ENSSSCT00000031205
Sequence length 132
Comment pep:novel scaffold:Sscrofa10.2:JH118884.1:612:12333:-1 gene:ENSSSCG00000029775 transcript:ENSSSCT00000031205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCFLCVSCVFLLGHLHIQMHLVKGDDLAVKTKFTIPLKEWLRLDISFNGGQIVVTASSGQ
DLENYHNQTISFREDFHYNDTDGYFIIGGSRYVAGIEGFFGPLKYYRLHALHPAQVSPGA
XXXXXXXXXXXX
Download sequence
Identical sequences ENSSSCP00000022667 ENSSSCP00000022667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]