SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022727 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022727
Domain Number 1 Region: 22-112
Classification Level Classification E-value
Superfamily Immunoglobulin 1.3e-33
Family V set domains (antibody variable domain-like) 0.0000669
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022727   Gene: ENSSSCG00000027295   Transcript: ENSSSCT00000030345
Sequence length 116
Comment pep:known chromosome:Sscrofa10.2:3:59958936:59959475:-1 gene:ENSSSCG00000027295 transcript:ENSSSCT00000030345 gene_biotype:IG_V_gene transcript_biotype:IG_V_gene
Sequence
MRAPMQLLSLLLLWLPGASCAIQMTQSPASLAASLGDTVSITCRASQSVSNNLAWYQQQA
GKAPKLLIYWASTLQSGVPSRFKGSVSGTDFTLTISGLQAEDVATYSCQQLNSAPP
Download sequence
Identical sequences ENSSSCP00000022727 ENSSSCP00000022727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]