SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022790 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022790
Domain Number 1 Region: 43-80
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 0.000000228
Family Inorganic pyrophosphatase 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022790   Gene: ENSSSCG00000022788   Transcript: ENSSSCT00000025642
Sequence length 85
Comment pep:novel chromosome:Sscrofa10.2:8:124773987:124790676:1 gene:ENSSSCG00000022788 transcript:ENSSSCT00000025642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALLQLLRTSGIRRAGAPAVAAARLPLGASAGPGPRRAMALYRTEERGQPHSPDYRLFF
KNVAGHYISPFHDIPLKVDSQEVLF
Download sequence
Identical sequences ENSSSCP00000022790 ENSSSCP00000022790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]