SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022813 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022813
Domain Number 1 Region: 245-339
Classification Level Classification E-value
Superfamily Immunoglobulin 2.42e-28
Family C1 set domains (antibody constant domain-like) 0.0000175
Further Details:      
 
Domain Number 2 Region: 38-124
Classification Level Classification E-value
Superfamily Immunoglobulin 5.78e-19
Family C1 set domains (antibody constant domain-like) 0.00074
Further Details:      
 
Domain Number 3 Region: 137-235
Classification Level Classification E-value
Superfamily Immunoglobulin 1.86e-18
Family C1 set domains (antibody constant domain-like) 0.000047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022813   Gene: ENSSSCG00000021006   Transcript: ENSSSCT00000029761
Sequence length 347
Comment pep:novel scaffold:Sscrofa10.2:GL896422.1:1698:3396:1 gene:ENSSSCG00000021006 transcript:ENSSSCT00000029761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPETAQLGWVQCLSGVWSAGRLPSHSPSCVSVSETSPKIFPLTLGSSEPAGYVVIACLVR
DFFPSEPLTVTWSPSREGVIVRNFPPAQAGGLYTMSSQVTLPVEQCPADQILKCQVQHLS
KSSQSVNVPCKVLPSDPCPQCCKPSLSLQPPALADLLLGSNASLTCTLSGLKKSEGVSFT
WQPSGGKDAVQASPTRDSCGCYSVSSILPGCADPWNKGETFSCTAAHSEGQTPDHALCPP
VNTFRPQVHLLPPPSEELALNELVTLTCLVRGFSPKDVLVRWLQGGQELPRDKYLVWESL
PTYAVTSVLRVDAEDWKQGDTFSCMVGHEALPLAFTQKTXSRPAHSP
Download sequence
Identical sequences ENSSSCP00000022813 ENSSSCP00000022813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]