SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022896 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022896
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 3.66e-19
Family Ribosomal L11/L12e N-terminal domain 0.0000279
Further Details:      
 
Domain Number 2 Region: 75-148
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 3.53e-18
Family Ribosomal protein L11, C-terminal domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022896   Gene: ENSSSCG00000030021   Transcript: ENSSSCT00000029393
Sequence length 167
Comment pep:novel scaffold:Sscrofa10.2:GL893103.2:4544:8128:-1 gene:ENSSSCG00000030021 transcript:ENSSSCT00000029393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKAXGWKGFATLGK
SYNVSLQVVQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRS
LARELSGKIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECPAVSD
Download sequence
Identical sequences ENSSSCP00000022896 ENSSSCP00000022896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]