SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022913 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022913
Domain Number 1 Region: 216-419
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.16e-29
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.014
Further Details:      
 
Domain Number 2 Region: 104-198
Classification Level Classification E-value
Superfamily RING/U-box 3.18e-22
Family Zf-UBP 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022913   Gene: ENSSSCG00000030435   Transcript: ENSSSCT00000027775
Sequence length 428
Comment pep:novel chromosome:Sscrofa10.2:3:62195034:62215487:-1 gene:ENSSSCG00000030435 transcript:ENSSSCT00000027775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRSKRESRGSTRGKRESESRSSSARVKRERDRERETEAPSSRSSPVRVKREVEPASAR
EAPAPVIPAVRVKRERDVDEDSEPEREVRAKNGRLDSEDQRSRHCPYLDTINRSVLDFDF
EKLCSISLSHINAYACLVCGKYFQGRGLKSHAYIHSVQFSHHVFLNLHTLKFYCLPDNYE
IIDSSLEDITYVLKPTFTKQQIANLEKQVKFSRAYDGTTYLPGIVGLNNIKANDYANAVL
QALSNVPPLRNYFLEEDNYKNIKRPPGDIMFLLVQRFGELMRKLWNPRNFKAHVSPHEML
QAVVLCSKKTFQITKQGDGVDFLSWFLNALHSALGGTKKKKKTIVTDVFQGSMRIFTKKL
PHPDLPAEEKEQLLHNDEYQETMVESTFMYLTLDLPTAPLYKDEKEQLIIPQVPLFNILA
KFNGITEK
Download sequence
Identical sequences ENSSSCP00000022913 ENSSSCP00000022913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]