SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022922 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022922
Domain Number 1 Region: 190-354
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.51e-21
Family Laminin G-like module 0.014
Further Details:      
 
Domain Number 2 Region: 29-170
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.92e-16
Family Laminin G-like module 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022922   Gene: ENSSSCG00000028259   Transcript: ENSSSCT00000023389
Sequence length 2064
Comment pep:known scaffold:Sscrofa10.2:JH118765.1:27321:45157:-1 gene:ENSSSCG00000028259 transcript:ENSSSCT00000023389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCRFPGLPLTAPSLHLALEALLLGGLKPKASFFGENHLEVPLATALPDIDLQLEFSTSQP
EALLLLAAGPVDHLLLQLYSGRLQVRLILGREEVRLQTLAEMLLSDSVPHTVGLTVSDSW
ASLSVDGLLNASALVQGGPLEVPYGLPYLRGASRPLRGCLHTATLNGRSLLRPLTPDVPE
GWAEEFSAGDDVALGFSGPHSLAAFPAWGTQDEGILEFTLTTRSRQAPLAFQAGGRHGDF
IYVDIFEGHLRAVVXLLHNSVPVADGQPHEVSIHVDAHRLEISVDQYPTRTSNRGVLSSL
EPRGSLLLGGLDAEASRPLQEHRLGLAVNVSLLGCLEDLSVNGQRWGLRDALLTRSXGPA
MELPEPCVPEPGLPPIFANFKPTLDLSEAELRKSQVLFSVSRGARHGELELDIPGAQARK
MFTLLDVVNRKARYVHDGSEDTSDQLVLEVSVTTRXGQTYILPIQINPVNDPPRVIFPHG
KVRHNTGLRLAQGSAAPVSPANLSVETNAVGQDVSVLFRVTSPLQFGELQKQGAGGAEGA
EWRPIQAFHQRDVEQGRVRYLSTDPQHRTEDTVESVALEVQVGPETLSNLSFPVTVQRAT
VWLLRLEPLDTQNTRQKALTTAHLEATLEEAGPNPTTFHYEVVQAPKKGNLRLQGTRLSD
GQGFTQDDLQAGRVTYGATARASEAVEDTFRFRVTAPPHFSPLYTFPIHISGDPDAPVLT
NVLLSVPEGGEGVLSADHLFVKSLNSASYLYEVMERPRHGRLAWWGAEDKVTTVTSFTNE
DLLHSRLVYQHDGSETTEDDIPFVATRQGEGSGGMAWEEVRGVFRVAIQPVNDHAPVQTI
SRVFHVARGGRRLLTTDDVAFSDADSGFADTQLVLTRKDLLFGSIVXFVHSGADRGWIQL
QVSDGQHQATALLEVQASEPYLRVTNGSSLVVPQGGQGTIDTAVLHLDTNLDIRSGDEVH
YRVTAGPHWGQLLRAGQPATSFSQQDLLDGAILYSHNGSLSPRDTLTFSVEAGPVHTDAT
LQVTIALEGPLAPLQLVQHKKIYVFQGEAAEIRRDQLEAAQEAVPPTDIMFSVRTPPSAG
YLVMLSHGTTAAEPPSLDPVHSFSQEAVDAGRVLYLHSHPEAWSDAFSLDVSSGLGAPLQ
GIRMELEVLPAAIPLEAQNFSVPEGGTRTLAPPLLRITGPYFPTLPGLDLQVLEPPRHGA
LRREEGPPDGALSTFPWTCPQVEQQLIHYVHDGSETLADSFILVANASEMDRQSHPVAFT
ITILPVNDQPPVLTTNTGLQMWEGATVPIPTEALRGADNDSGPEDLVYTLAARQRPSVKT
RIEPQEGSDRYAAGITEPSMLYQWGQQPSLKLSFCYGPLSAPPHNEIFSRLEAVAAVHPE
SLGAFVTGCPAGFQSSGSLPTSLRVSISSPPTHWPGMTHLGEERQEMVRAVSSERKEAGI
SLQKRKGVYAGNVLYEHEMPPEPFWEARDTLELQLSSPPAPDVATTXACPQRPSRLWRNK
GLWVSEGQRAEXASNLLASVPSPQRLEHDVLFQITQFPTRGQLLVSEEPLHAGRPHFLQS
ELASGFRFRAHLQGPAGTLVAGPHTSEAFAITVRDVNERPPQPQASIPLRLTRGSRSPLS
RAQLSVVDPDSAPGEIEYEVQRAPHNGYLSLPGASPGPVTRFMAFVANGSSVAGIFQLSV
SDGASPPLPMSLVVDVLPSAIEVQLRAPLEVPQAVGRSSLSRQQLQVVSDREELDAAYRX
AFSQLQVDQGEVVFAFTNFSSPHDQFSILALARGANASATVNVTVRALLHVWTGGXWPQG
PTLRLDPTVLDAGELANHTGSVPRFRLLAGPRHGRVVRVPRARTEPRGGQLVEQFTQQDL
EDGRLGLEVGRPEGSPPGPAGDSLTLELWARGVPPAVASLDFATEPYNAARPYSVALLSL
PEAARTEAGKPESSTPTGKPGPAASSPVPAVARGGFLGFLEANMFSIIIPVCLVLLLLAL
ILPLLFYLRKRNKTGKHNVQVLTAKPRNGLAGDNETFRKVDPGQAIPLTAVHGQGPPQGG
QPDPELLQFCRTSNPALKNGQYWV
Download sequence
Identical sequences ENSSSCP00000022922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]