SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022942 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022942
Domain Number 1 Region: 9-133
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.88e-19
Family Growth factor receptor domain 0.0066
Further Details:      
 
Domain Number 2 Region: 128-197
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.88e-19
Family TB module/8-cys domain 0.00082
Further Details:      
 
Domain Number 3 Region: 240-380
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.41e-16
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 4 Region: 371-482
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000091
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 5 Region: 202-240
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000112
Family EGF-type module 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022942   Gene: ENSSSCG00000022967   Transcript: ENSSSCT00000022925
Sequence length 482
Comment pep:novel chromosome:Sscrofa10.2:2:71523268:71539163:-1 gene:ENSSSCG00000022967 transcript:ENSSSCT00000022925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLSCPCPADVDECALNSLLCDNGRCWNSPGSYSCSCPQGFSFRQDTETCEDIDECLSNPC
VNGVCRNLAGSYACECAPGSRLGPSGTVCLDVNECEVFPGVCTNGHCLNTAGSFRCQCPE
GLTLDATGRLCVDVRLELCYLRWDEDECGAALPGKYRMDVCCCSVGAAWGATCEACPKPE
SAAFASLCPRGLGFARDKRGYIDECSLSDGLCPHGHCVNVIGAFQCSCHHGFQSTADLQG
CVASADTDECRAGNGGCQVHCVNTEGSYQCSCGQGYSLMPDGRACADLDECELGGHSCDS
HASCLNIPGSFSCRCQPGWVGDGFECHDRDECAFQEHGCSPRADCLNIPGSYRCSCHPGF
TGDGFSCEDRDECAENVDLCENGQCLNAPGGYRCECEMGFNPTEDQRACQDVDECVLGNL
CVFGICENLPGMFRCVCDEGYELDRSGGNCTDVNECADPVNCINGLCVNTPGSYQCNCPQ
DF
Download sequence
Identical sequences ENSSSCP00000022942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]